You have 10 seconds to be as /sci/ as possible.
extremely funny
>>24100550
Physics ,nigga
Can science explain consciousness?
>>24100550
that is some sexy handwriting
i dont know why but my handwriting is also really good when writing numbers or just doing math.
>>24100550
Physics is basically just magic that we can explain
>>24100550
Did you know that the human anus is a muscle?
Did yuo know that anuses are muacels?
Did you know that anus?
0.999... =/= 1 because hyperreals have no influence in the realm of reals.
>>24100844
provided my camera gets better
>>24100830
https://en.wikipedia.org/wiki/Quantum_mind
>biology
>science
>>24100913
Did you know that the combined strength of 20 human anuses is enough to sever your arm?
>>24100550
i just divided by zero
>>24100920
Can you please help me out on this problem?
find dy/dx for e^(x+1)(2x+1) + y = ln(y)
>gi|5453730|ref|NP_006430.1| protein mab-21-like 2 [Homo sapiens]
MIAAQAKLVYQLNKYYTERCQARKAAIAKTIREVCKVVSDVLKEVEVQEPRFISSLSEIDARYEGLEVIS
PTEFEVVLYLNQMGVFNFVDDGSLPGCAVLKLSDGRKRSMSLWVEFITASGYLSARKIRSRFQTLVAQAV
DKCSYRDVVKMIADTSEVKLRIRERYVVQITPAFKCTGIWPRSAAQWPMPHIPWPGPNRVAEVKAEGFNL
LSKECYSLTGKQSSAESDAWVLQFGEAENRLLMGGCRNKCLSVLKTLRDRHLELPGQPLNNYHMKTLLLY
ECEKHPRETDWDESCLGDRLNGILLQLISCLQCRRCPHYFLPNLDLFQGKPHSALESAAKQTWRLAREIL
TNPKSLDKL
Amino acid sequence for the mab-21-like 2 gene.
>>24100830
Nope, that's what faith is for. STEM spergs are actually very bad at abstract thought so they try to quantify everything into absolutes. I hope this message finds you in good faith, and remember to have a blessed day.
>>24100973
Did you know that humans evlolved asses for the purpose of sitting?
>>24100550
>1/0 = infinity
Here's something I read about today
>pic related
>>24100973
go fuk urself.
>>24101016
Gr2^3b(sqrt64)
>>24100973
e^(2x^2 + 3x + 1) + y = ln(y)
take d/dx both sides...
(4x + 3) * e^(2x^2 + 3x + 1) + (dy/dx) = (1/y) * (dy/dx)
(4x + 3) * e^(2x^2 + 3x + 1) = (dy/dx)[1/y - 1]
[(4x + 3) * e^(2x^2 + 3x + 1)]/[1/y - 1] = dy/dx
My Iq is 170
>>24100973
Why don't you try differentiating both sides implicitly? Use chain rule for the exponential part.
Real nigga crib sheet
>>24101169
>anything i dont like is Gr2^24b
>1/0 = infinity
kill yourself
who /STEM/ here?
>>24101212
>tfw graduating this year with an EE degree and I dont recognize most of this.
Undergrad degrees are fucking worthless just end me senpai.
>>24101277
Don't have a degree yet. Currently an undergraduate (mathfag)
>>24101091
>>24101277
The whole thing is supposed to be a joke. Can't you take a joke?
>>24101246
This is what faith is for. Have a blessed day.
The result is trivial and is left as an exercise to the reader.
>PhD in math
>any job I want
>300k starting
>>24101246
wtf is gr16777216b
>>24101371
I have discovered a truly marvellous proof of this, which this margin is too narrow to contain.
>>24101446
What topic did you pursue for your PhD. thesis? Number Theory? Complex Analysis?
>>24101546
Triple integrals
![20151108_003915[1].jpg](https://i.imgur.com/34mfoOg.jpg "20151108_003915[1].jpg")
>>24101191
>>24101203
Thanks guys, I figured it out after going through a few other problems and then coming back for this one.
Does the way I write out the problem look confusing? I'd like to know your opinions because sometimes I confuse myself with my solutions.
>>24101579
Kudos. I hate math even though I'm good at it. That's a rare skill so you get rare dough. I'm good with stocks, going for a blue collar job to start saving with myself.
>>24100550
I am absolutely certain that this religious post is completely sincere and not a troll post and shall be sure to hurl as many fedoras with of butthurt at it as I can. also I will ask to have a religion board to handle all these tru and honest religion posts that are getting posted here!
>>24101637
Do you even /sci/?
>>24101679
Just read about it :( I wanted to do neuroscience, but I needed the income from learning a technical skill more. Was going to do liberal arts, then neuroscience, with a focus on meditative practices or any kind of interesting study of cognition.
ive been working on a math problem for 5 years
ask me how im doing
>
>>24101747
Bruh. I was posting /sci/memes. No actual PhD.
Also, pursue stock trading. Remember, college is an investment, so don't go and waste it on liberal arts or meditation unless you can generate money from that.
>>24101771
how are you doing
>>24101771
what math problem
>>24101920
If timmy has 3 apples and eats 1 apple, how many apples does timmy have left?
>>24101915
shitty; crying
>>24101920
secret
>>24101920
x=x+1
>>24101938
the null set
>>24101956
any x, where x belongs to Z1={0}
>>24101633
looks good to me
>>24101633
Your answer is correct but your notation and writing style is really unclear, btw, you should cover the "4x+3" part with brackets.
pic related. I made your work a bit neater and easier to follow.
>>24101579
LINK TO PAPER PLS!
>>24102017
thank you anon, I'll clean it up a bit
>>24101199
My iq is 80-90 but I say it's 130 often.
Studies show that over 99% of people who have someone they call a best friend, will forget about said "friend" in less tan 3 years average
is math /sci/?trying to figure out how to make complex architecture in a rudimentary level designing software for a 3d indie game by calculating dimensions so I can input specific values for seamless edges in-game.this is every layer I have in the photoshop document I'm usingsome of it is probably old/wrong information, the green is the new info.yes, I realize this is early highschool geometry, but I like how "smart" it looks
>>24100550
Unfortunately, infinity isn't a number - it's a bound. Nothing can "equal" infinity.
>>24100550
But if you rotate 90 degrees, you get
- | O
And that doesn't make any sense.
>>24105217
-10
>>24101771
lmfaooooooo how do you spend t fucking years on a math problem ? its literally basic addition and subraction
>bayesian probability will decide everything in the future
>we discover math
>non-STEM is uselessi've never been to sci. am i close?
>>24100550
I'm majoring in STEM and I am better than you.
a^2 + b^2 = c^2
Had to look it up to be sure though.
>>24106397
Would you mind defining the variables a, b and c?
Also, please prove it.
>>24106436
WE NEED A BIGGER MARGIN!!!
>muh olivine
>muh peridotite
>muh geology
Hey, can you write this?
With proper syntax of course.
>>24106436
Ahh, fuck it, I don't know. The letters are the sides of a triangle that has a 90 angle.
>>24106489
BRAVO NOLAN
>>24106436
Original content level three
>>24106581
That is not a generalized proof son, try again.
Also:
>engineers eat dicks
>reals do not even exist
>biology
>0=1?
>Linear Algebra is hard as balls guys
>r8 my major
>college thread
>300k starting
>failed my chem exam second time
/sci/ is a fucking joke.
>>24106674
>That is not a generalized proof son, try again.
like, just use your imagination, man
>>24101322
Its not a joke. How many zero's in any number? Can be as many as possible, hense infinity
>>24101371
I haven't solved it because I don't understand the question. But n can't be 0
>>24106889
Just prove it desu senpai.
It is trivial, really.
>>24106889
n is defined as greater two.
>>24106674
Here's a better proof
>>24106889
You haven't proven it, because Fermat's last theorem is difficult as fuck.
The joke is that he apparently found a truly marvelous proof of this, but he didn't write it down, because the margin was too narrow to contain it.
Sun vs sun of ice,who wins?
Engineers are gay.
>>24108375
define "ice"
>>24100550
"I study STEM and will have a better paying job than all those faggots who study useless stuff like medecine or law".
/sci/ in a nutshell.
I think I'm more intelligent than your average person because I memorize loads of formulas about the physical universe that some genuinely intelligent people discovered.
